The human gene for the enkephalins was isolated and its sequence described in 1982.[4]
The human gene for dynorphins (originally called the "Enkephalin B" gene because of sequence similarity to the enkephalin gene) was isolated and its sequence described in 1983.[5]
The PNOC gene encoding prepronociceptin, which is cleaved into nociceptin and potentially two additional neuropeptides.[1]
†This symbol next to a receptor indicates that the corresponding peptide is a principal endogenous agonist of the receptor in humans. ‡This symbol next to a receptor indicates that the corresponding peptide is the endogenous ligand with the highest known potency for the receptor in humans.
Stefano GB, Ptáček R, Kuželová H, Kream RM (2012). "Endogenous morphine: up-to-date review 2011"(PDF). Folia Biol. (Praha). 58 (2): 49–56. PMID22578954. Positive evolutionary pressure has apparently preserved the ability to synthesize chemically authentic morphine, albeit in homeopathic concentrations, throughout animal phyla.... The apparently serendipitous finding of an opiate alkaloid-sensitive, opioid peptide-insensitive, µ3 opiate receptor subtype expressed by invertebrate immunocytes, human blood monocytes, macrophage cell lines, and human blood granulocytes provided compelling validating evidence for an autonomous role of endogenous morphine as a biologically important cellular signalling molecule (Stefano et al., 1993; Cruciani et al., 1994; Stefano and Scharrer, 1994; Makman et al., 1995).... Human white blood cells have the ability to make and release morphine
"μ receptor". IUPHAR/BPS Guide to PHARMACOLOGY. International Union of Basic and Clinical Pharmacology. 15 March 2017. Retrieved 28 December 2017. Comments: β-Endorphin is the highest potency endogenous ligand... Morphine occurs endogenously (Poeaknapo et. al. 2004)... Principal endogenous agonists (Human) [are] β-endorphin (POMC, P01189), [Met]enkephalin (PENK, P01210), [Leu]enkephalin (PENK, P01210), citing:
"δ receptor". IUPHAR/BPS Guide to PHARMACOLOGY. International Union of Basic and Clinical Pharmacology. 15 May 2017. Retrieved 28 December 2017. Principal endogenous agonists (Human) [are] β-endorphin (POMC, P01189), [Leu]enkephalin (PENK, P01210), [Met]enkephalin (PENK, P01210)
"κ receptor". IUPHAR/BPS Guide to PHARMACOLOGY. International Union of Basic and Clinical Pharmacology. 21 February 2017. Retrieved 28 December 2017. Comments: Dynorphin A and big dynorphin are the highest potency endogenous ligands... Principal endogenous agonists (Human) [are] big dynorphin (PDYN, P01213), dynorphin A (PDYN, P01213)
"Dynorphin A 1–8". HMDB Version4.0. Human Metabolome Database. 27 September 2017. Retrieved 20 October 2017. Dynorphin A (1–8) is a fraction of Dynorphin A with only Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile peptide chain.
"Big dynorphin: Biological activity". IUPHAR/BPS Guide to PHARMACOLOGY. International Union of Basic and Clinical Pharmacology. Retrieved 20 October 2017. Principal endogenous agonists at κ receptor.
"Big dynorphin: Structure– Peptide Sequence". IUPHAR/BPS Guide to PHARMACOLOGY. International Union of Basic and Clinical Pharmacology. Retrieved 20 October 2017. Peptide sequence YGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVT
"Dynorphin B (1-29)". PubChem Compound. United States National Library of Medicine– National Center for Biotechnology Information. 23 December 2017. Retrieved 28 December 2017.
Suda M, Nakao K, Yoshimasa T, Sakamoto M, Morii N, Ikeda Y, Yanaihara C, Yanaihara N, Numa S, Imura H (September 1984). "Human leumorphin is a potent, kappa opioid receptor agonist". Neuroscience Letters. 50 (1–3): 49–52. doi:10.1016/0304-3940(84)90460-9. PMID6149506. S2CID42419724.
Inenaga K, Nagatomo T, Nakao K, Yanaihara N, Yamashita H (January 1994). "Kappa-selective agonists decrease postsynaptic potentials and calcium components of action potentials in the supraoptic nucleus of rat hypothalamus in vitro". Neuroscience. 58 (2): 331–340. doi:10.1016/0306-4522(94)90039-6. PMID7908725. S2CID24631286.
"NOP receptor". IUPHAR/BPS Guide to PHARMACOLOGY. International Union of Basic and Clinical Pharmacology. 18 August 2017. Retrieved 28 December 2017. Natural/Endogenous Ligands nociceptin/orphanin FQ